PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009604043.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 340aa    MW: 37574.5 Da    PI: 8.6703
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009604043.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.25.8e-18184238256
                     T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     rk+ ++tkeq   Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  XP_009604043.1 184 RKKLRLTKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 238
                     788899***********************************************98 PP

2HD-ZIP_I/II127.55.7e-41184274192
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                     +kk+rl+keq+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l+een+rL+ke +eLr +lk
  XP_009604043.1 184 RKKLRLTKEQSAFLEESFKEHNTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKKCCETLTEENKRLQKELQELR-ALK 274
                     69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.21E-18173241IPR009057Homeodomain-like
PROSITE profilePS5007117.135180240IPR001356Homeobox domain
SMARTSM003896.9E-16182244IPR001356Homeobox domain
CDDcd000869.41E-15184241No hitNo description
PfamPF000461.7E-15184238IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.9E-17184238IPR009057Homeodomain-like
PROSITE patternPS000270215238IPR017970Homeobox, conserved site
SMARTSM003407.1E-25240283IPR003106Leucine zipper, homeobox-associated
PfamPF021836.0E-10240274IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MELALSLGGD TPKSFLFLEK SSSSSSLHEK LNSSKDLGFC MGLGKCNEDK IRKNKQRRSQ  60
DLKEDHESKG SSDPLLQLDL LPFSPVSRDT SSQLHFPWLT ENIAAEPGPA GKVLNMNRRQ  120
LVAEEAEEGA ALSSPNSAIS TFQVNIPIYR NGNMLLGKRE SEGDVERWGN SSSRASDEED  180
GSARKKLRLT KEQSAFLEES FKEHNTLNPK QKLALAKQLN LRPRQVEVWF QNRRARTKLK  240
QTEVDCEYLK KCCETLTEEN KRLQKELQEL RALKSSQPFY MQLPATTLTM CPSCERVVTA  300
TSSAAAASAA AAAANTTLTL AKPGPFPFSP AQVQAPQAAS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1232240RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009604043.10.0PREDICTED: homeobox-leucine zipper protein HAT14 isoform X1
SwissprotP466651e-95HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A068URD41e-143A0A068URD4_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000609511e-133(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA29024186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.17e-71homeobox from Arabidopsis thaliana